EasyManua.ls Logo

Funkwerk elmeg CS410 - Telephone and PC; CTI; TAPI using the phone’s USB port; CAPI using the telephone’s USB port

Funkwerk elmeg CS410
129 pages
Print Icon
To Next Page IconTo Next Page
To Next Page IconTo Next Page
To Previous Page IconTo Previous Page
To Previous Page IconTo Previous Page
Loading...
s macro:
Programming macro buttons macro«
softkey)
Please select a function key first. First enter a
name for that macro (max. 20 characters.
Then enter the separate macro commands.
A macro’s command string is limited to 26
characters. Eachcommand orbuttonsimula
-
tionconsistsoftwocharacters.Youcanthere
-
foreonlylinkamaximumof13commandsto
-
gether,or,forexample,join7commands/key
stroke simulations with a further 12 digits.
Commands and keys for macro programming
A macro consists of variouscommands, orecallflash button strokes, that arecompiled into one command
sequence and stored under a defined direct dialing key. When this function key is pressed, the individual
commands contained in the macro are executed one after the other.
The following commands are available for macro programming:
»B« Initiatingacall(sameasliftingthehandset)
»D« Endingacall(sameasreplacingthehandset)
»ELSE« Alternativecommand,ifarequiredcondition(e.g.»IFLA«oIFLB«)isnotfulfilled.
»IFLA«
»IFLB«
ExecutethismacroonlywhentheLEDforthefirstlevelisoffIFLA«)orflashesIFLB«).
Ifthisconditionisnotfulfilledtheprocedureisdiscontinued,orresumedafterthecommand
»ELSE«(whereavailable).
»K« Keypadsequence;allofthefollowingcharacters/digitsaretransmittedasakeypadsequence.
»LA« DeactivateLED
»LB« TheLEDflashes
»LE« ActivateLED
»LZ« ActivateLEDfortwoseconds
»n« Dummynumber.
If a number is entered prior to execution of a macro (or for example, dialed from the tele
-
phone)thisnumberisusedinplaceofthedummynumberinthemacro.
»P« Pause(1second)inthecommandsequence(betweentwocharacters/commands)
»RE« Re-establishthephonesidlestate.
Ifthereisanactiveconnectionatthisphone,executionofthismacroiscanceledatthispoint.
»SE« Activatingthespeaker(normalvolume)
»SA« Activatingthespeaker(lowvolume)
»T« DTMF-Sequenz:allofthefollowingcharacters/digitsaretransferredasDTMFdialing.
88

Table of Contents

Other manuals for Funkwerk elmeg CS410

Related product manuals