EasyManua.ls Logo

Tektronix MDO4000B Series User Manual

Tektronix MDO4000B Series
1158 pages
To Next Page IconTo Next Page
To Next Page IconTo Next Page
To Previous Page IconTo Previous Page
To Previous Page IconTo Previous Page
Page #447 background imageLoading...
Page #447 background image
Commands Listed in Alphabetical Order
MATH[1]:TYPe
This command specifies the math type (DUAL, FFT, ADVanced or
SPECTRUM
). This command is used along with MATH[1]:DEFine, which specifies
the current mathematical expression as a text string which defines the waveform.
You must specify the math type before defining the math expression. For a listof
math expres
sions, see MATH[1]:DEFine.
Group
Math
Syntax
MATH[1]:TYPe {DUAL|FFT|ADVanced|SPECTRUM}
MATH[1]:TYPe?
Arguments
DUAL sets the type to dual waveform math, which can use any combination of live
analog or reference waveforms in the time domain display.
FFT sets the type to FFT math, which can use any live analog or reference
waveform in the time domain.
NOTE. You can also use FFT as part of a math expression by declaring the type
ADVanced.
See examples for the command MATH[1]:DEFine.
ADVanced sets the type to advanced math.
SPECTRUM sets the type to spectrum, which can use any combination of live
RF or reference traces in the frequency domain. (MDO3000, MDO4000/B, or
MDO4000C models with option SA3 or SA6 only.)
Examples
MATH:TYPE FFT sets the math type to FFT.
MATH:TYPE FFT;:MATH:DEFI
NE “FFT( CH1 )”;:SELECT:MATH1
sets the
math type to
FFT and displays an FFT waveform of the channel 1 waveform,
using the current FFT scale and window settings.
MATH:TYPE ADVANCED;:MATH:DEFINE
“INTG(REF1*CH3)+DELAY(CH1,CH2)”;:SELEC T:MATH1
sets the math type to
ADVanced anddisplaysanadvancedmathwaveformthatistheINTEGRAL
of the product of REF1 and CH3 plus the result of the delay measurement
between channel 1 and 2.
MATH[1]:VERTical:POSition
This command specifies the vertical position of the currently selected math type.
MDO4000/B/C, MSO/DPO4000B and MDO3000 Series Oscilloscopes Programmer Manual 2-417

Table of Contents

Question and Answer IconNeed help?

Do you have a question about the Tektronix MDO4000B Series and is the answer not in the manual?

Tektronix MDO4000B Series Specifications

General IconGeneral
Bandwidth100 MHz to 1 GHz
Form FactorBenchtop
Vertical Resolution8 bits
Input CouplingAC, DC, GND
Timebase Accuracy± 1 ppm
Operating Temperature0 °C to +50 °C
Built-in Spectrum AnalyzerYes
Channelsup to 4 analog channels
Record Lengthup to 20 Mpoints
Display10.4 inch (264 mm) color TFT LCD
ConnectivityUSB, LAN, GPIB (optional)
RF Capture BandwidthUp to 1 GHz
Arbitrary/Function Generatoroptional
Input Impedance1 MΩ || 13 pF
Trigger TypesEdge, Pulse Width
Protocol AnalysisI2C, SPI, CAN, LIN, RS-232/422/485/UART, USB 2.0, Ethernet, FlexRay, MIL-STD-1553

Related product manuals