EasyManua.ls Logo

Adobe PREMIERE PRO 2 - Add Clips from Multiple Cameras to a Sequence; Create the Multi-Camera Target Sequence; Record the Multi-Camera Edits; Synchronize the Clips in the Sequence

Adobe PREMIERE PRO 2
448 pages
Print Icon
To Next Page IconTo Next Page
To Next Page IconTo Next Page
To Previous Page IconTo Previous Page
To Previous Page IconTo Previous Page
Loading...
ADOBE PREMIERE PRO 2.0
User Guide
151
1. Add clips from multiple cameras to a sequence.
Stack the clips from each camera on separate tracks of a sequence. (See “To add clips for multi-camera editing” on
page 152.)
2. Synchronize the clips in the sequence.
Mark the sync point with numbered clip markers, or reassign the sync point for each camera to a specific timecode.
(See “To synchronize clips” on page 152.)
3. Create the multi-camera target sequence.
The final edits are made in a target sequence. You create the target sequence by nesting the sequence of synchronized
clips into a new sequence. Then you enable the clip in the target sequence for multi-camera editing. (See To create
a multi-camera target sequence” on page 153.)
4. Record the multi-camera edits.
In the Multi-Camera Monitor, you can view the footage of all four cameras simultaneously and switch between
cameras to choose footage for the final sequence. (See “To record multi-camera edits” on page 153.)
5. Adjust and refine edits.
You can rerecord the final sequence and substitute clips with footage from one of the other cameras. You can also
edit the sequence like any other sequence—using the standard editing tools and techniques, adding effects, or
compositing using multiple tracks. (See “To record multi-camera edits” on page 153and “To adjust multi-camera
edits in the Timeline panel” on page 154.)
For a tutorial on multi-camera editing, go to Resource Center on the Adobe website. Adobe periodically provides
updates to software and Help. To check for updates, click the Open Preferences Dialog button in Adobe Help
Center, and then click Check For Updates. Follow the on-screen instructions.
Using the Multi-Camera Monitor
The Multi-Camera Monitor plays the footage from each camera and a preview of the final edited sequence. When
yourecordthefinalsequence,youclickacamerapreviewtomakeitactiveandrecordfootagefromthatcamera.The
active camera is indicated by a yellow border when in playback mode and a red border when recording.
Note: IftheMulti-CameraMonitordisplaysthesameframeinlargepreviewsonboththeleftandrightside,thecurrent
clip is either not a multi-camera clip or a multi-camera clip that is not enabled.
To display the Multi-Camera Monitor, select the multi-camera target sequence in the Timeline panel, and then
choose Multi-Camera Monitor from the Source or Program Monitor panel menu.

Table of Contents

Related product manuals